St3gal6 (NM_018784) Mouse Recombinant Protein

CAT#: TP504835

Purified recombinant protein of Mouse ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (St3gal6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
ST3GAL6 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204835 protein sequence
Red=Cloning site Green=Tags(s)

MKGYLVAIFLSSIFLYYVLYCILWGTNGYWFPAEEMRTRNNVNNCFKKPAFANLLRFPQLYPFLCRADFI
KVAAMSGTNNFPLPYGIKTFETYFSSALSKLQSCDLFDEFDRVPCKRCVVVGNGGVLKNKTLGATINSYD
VIIRMNNGPVLGHEEEVGTRTTFRLFYPESVFSDSSHYDPNTTAVLVVFKPQDLRWLVEILLGKKINTQG
FWKTPALKLIYKQYQIRILDPYITSEAAFQMLRFPRVFPKDQKPKHPTTGIIAITMAFHICSEVHLAGFK
YNFYSPNSPLHYYGNATMSLMKQNAYHNLTAEQLFLNDIIKKKMVINLT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_061254
Locus ID 54613
UniProt ID Q8VIB3
Refseq Size 1593
Cytogenetics 16 C1.2
Refseq ORF 990
Synonyms 1700023B24Rik; AI930218; AW552396; Siat10; St3galVI
Summary Involved in the synthesis of sialyl-paragloboside, a precursor of sialyl-Lewis X determinant. Has a alpha-2,3-sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. Has a restricted substrate specificity, it utilizes Gal-beta1,4-GlcNAc on glycoproteins, and neolactotetraosylceramide and neolactohexaosylceramide, but not lactotetraosylceramide, lactosylceramide or asialo-GM1 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...