Rcn3 (NM_026555) Mouse Recombinant Protein

CAT#: TP504819

Purified recombinant protein of Mouse reticulocalbin 3, EF-hand calcium binding domain (Rcn3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204819 protein sequence
Red=Cloning site Green=Tags(s)

MMWRWSFLLLLLLLRHWALGKPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDK
LSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRN
ATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLE
DLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGQLDGSEVGYWVLPPSQDQPLV
EANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080831
Locus ID 52377
UniProt ID Q8BH97
Refseq Size 1453
Cytogenetics 7 29.11 cM
Refseq ORF 987
Synonyms 6030455P07Rik; D7Ertd671e; D530026G20Rik; RLP49
Summary Probable molecular chaperone assisting protein biosynthesis and transport in the endoplasmic reticulum (PubMed:26252542). Required for the proper biosynthesis and transport of pulmonary surfactant-associated protein A/SP-A, pulmonary surfactant-associated protein D/SP-D and the lipid transporter ABCA3 (PubMed:26252542). By regulating both the proper expression and the degradation through the endoplasmic reticulum-associated protein degradation pathway of these proteins plays a crucial role in pulmonary surfactant homeostasis (PubMed:26252542). Has an anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens (By similarity). This calcium-binding protein also transiently associates with immature PCSK6 and regulates its secretion (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...