Tmem59 (NM_029565) Mouse Recombinant Protein

CAT#: TP504691

Purified recombinant protein of Mouse transmembrane protein 59 (Tmem59), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
TMEM59 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204691 protein sequence
Red=Cloning site Green=Tags(s)

MAAPKGKLWVQAQLGLPPLLLLTMALAGGSGTAAAEAFDSVLGDTASCHRACQLTYPLHTYPKEEELYAC
QRGCRLFSICQFVDDGLDLNRTKLECESACTEAYSQPDEQYACHLGCQDQLPFAELRQEQLMSLMPRMHL
LFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPQLEQEPTNLRESSLSKMSYL
QMRNSQAHRNYLEEEESDGFLRCLSLNSGWILTTTLVLSVMVLLWICCAAVATAVEQYVPPEKLSIYGDL
EFMNEQKLSRYPAPSLVIVRSQTEEHEEAGPLPTKVNLAHSEI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083841
Locus ID 56374
UniProt ID Q9QY73
Refseq Size 1562
Cytogenetics 4 50.12 cM
Refseq ORF 972
Synonyms 1110001M20Rik; 3110046P06Rik; AI256529; D4Ertd20e; MTDCF1; ORF18
Summary Acts as a regulator of autophagy in response to S.aureus infection by promoting activation of LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C). Acts by interacting with ATG16L1, leading to promote a functional complex between LC3 and ATG16L1 and promoting LC3 lipidation and subsequent activation of autophagy. Modulates the O-glycosylation and complex N-glycosylation steps occurring during the Golgi maturation of several proteins such as APP, BACE1, SEAP or PRNP. Inhibits APP transport to the cell surface and further shedding.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...