Acy3 (NM_027857) Mouse Recombinant Protein

CAT#: TP504580

Purified recombinant protein of Mouse aspartoacylase (aminoacylase) 3 (Acy3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204580 protein sequence
Red=Cloning site Green=Tags(s)

MSSLPGSREPLLRVAVTGGTHGNEMCGVYLARYWLQNPGELQRPSFSAMPVLANPAATAACCRYLDRDLN
RSCTLTFLGSTATPDDPYEVKRARELNQLLGPKGTGQAFDFTLDLHNTTANTGVCLISESNISFNLHLCH
YLQRQNPGMPCRLFLYEPAGTETFSVESISKNGICLEMGPQPQGVLRADLFSRMRALVASILDFIELFNQ
GMDLPAFEMDIYRNLGSVDFPRTADGDLAGTVHPQLQDHDFEPLRPGEPIFKLFSGEDVLYEGDSIVYPV
FINEAAYYEKHVAFLKSEKIRVTVPALLRLTPRSTQTP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 71670
UniProt ID Q91XE4
Refseq Size 1505
Cytogenetics 19 A
Refseq ORF 957
Synonyms 0610006H10Rik; AA3; AAIII; Acy-3; AW107362; HCBP1
Summary This gene encodes a member of the aminoacylase family of enzymes. This enzyme specifically deacetylates N-acetyl aromatic amino acids and mercapturic acids. Action of this enzyme on metabolites of the environmental contaminant trichloroethylene leads to the generation of toxic products that may lead to kidney failure. This protein has been found to bind to the hepatitis C virus core protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...