Ggh (NM_010281) Mouse Recombinant Protein

CAT#: TP504547

Purified recombinant protein of Mouse gamma-glutamyl hydrolase (Ggh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204547 protein sequence
Red=Cloning site Green=Tags(s)

MANLGYLLCLLGLLLCGLSSPGMSRPYNHGSERPIIGVVMQECFGKMAKLGNYYIAASYVKYIESAGARV
VPIRPDLSDAEYEELFRSINGVLLPGGGANLTDSGYSRVAKIFFSKALESFDNGGHFPVWGTCLGFEELS
VLVSGENLLTSTDTKSKKLPLNFTEGARKSRMFKHFPTELLDSLALENLTANFHKWSLSVKNFTENEKLK
KFFNILTTNTDGKTEFISSMEGFKYPVYAVQWHPEKAPFEWKNLGGISHAPNAVKTSFYLAEFLVSEARK
NSHHFENVVKETASLIYKVYPIYTGNISSFQQAYMFD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034411
Locus ID 14590
UniProt ID Q9Z0L8
Refseq Size 1340
Cytogenetics 4 A3
Refseq ORF 954
Synonyms gamma-GH
Summary Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates. Acts as endopeptidase. Lysosomal enzyme is activated by sulfhydryl compounds.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...