Rdh11 (NM_021557) Mouse Recombinant Protein
CAT#: TP504536
Purified recombinant protein of Mouse retinol dehydrogenase 11 (Rdh11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204536 protein sequence
Red=Cloning site Green=Tags(s) MFGFLLLLSLPFILYLVTPKIRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACR DVDKGELAAREIQAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFE MHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYSAGLAYCHSKLANILFT KELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSH FSDCQLAWVSYQGRNEIIARRLWDVSCDLLGLPVDW myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 35.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067532 |
Locus ID | 17252 |
UniProt ID | Q9QYF1 |
Refseq Size | 1574 |
Cytogenetics | 12 35.51 cM |
Refseq ORF | 951 |
Synonyms | 2610319N22Rik; AI428145; Arsdr1; AU045252; C85936; CGI-82; HCBP12; M42C60; Mdt1; Psdr1; SCALD |
Summary | Retinol dehydrogenase with a clear preference for NADP (PubMed:12807874, PubMed:29567832). Displays high activity towards 9-cis, 11-cis and all-trans-retinol, and to a lesser extent on 13-cis-retinol (By similarity) (PubMed:12807874). Exhibits also reductive activity towards toxic lipid peroxidation products such as medium-chain aldehydes trans-2-nonenal, nonanal, and cis-6-nonenal (PubMed:12807874). Has no dehydrogenase activity towards steroid (PubMed:12807874). Seems to be required for homeostasis of retinol in liver and testis (PubMed:29567832).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |