Rhbdd1 (NM_029777) Mouse Recombinant Protein
CAT#: TP504515
Purified recombinant protein of Mouse rhomboid domain containing 1 (Rhbdd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204515 protein sequence
Red=Cloning site Green=Tags(s) MQRRTRGINTGLLLLLSQVFQIGINNIPPVTLATLAVNVWFFLNPWKPLYHSCISVEKCYQQKDWQRLLL SPLHHGDDWHLYFNMVSMLWKGVKLERRLGSRWFAYVIATFSLLTGVVYLLLQFTVAELMNQPDFKRNCA VGFSGVLFALKVLSNHYCPGGFVNILGFPVPNRFACWAELVAIHFCTPGTSFAGHLAGILVGLMYTQGPL KKIMDMCAGIFISHSGPSGQQNHFNNAGPSGYQNHYADGRPVTYDATYRNYDVYTAGLSEEEQLERALRA SIWDRGNTRNGPMPYGFRLPPEEMRRQRLHRFDGQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 35.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_084053 |
Locus ID | 76867 |
UniProt ID | Q8BHC7 |
Refseq Size | 3533 |
Cytogenetics | 1 C5 |
Refseq ORF | 948 |
Synonyms | 4930418P06Rik; mRHBDD1; RRP4 |
Summary | Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |