Auh (NM_016709) Mouse Recombinant Protein
CAT#: TP504476
Purified recombinant protein of Mouse AU RNA binding protein/enoyl-coenzyme A hydratase (Auh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204476 representing NM_016709
Red=Cloning site Green=Tags(s) MAAAAPGALGALRTVGVRLVAACCARLGPAAWARGTAPRRGYSSEVKTEDELRVRHLEEENRGIVVLGIN RAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMHSSEVGPFVSKIRSVI NDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKE LIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGL AIEEACYAQTISTKDRLEGLLAFKEKRPPRYKGE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057918 |
Locus ID | 11992 |
UniProt ID | Q9JLZ3, A0A0R4J023 |
Refseq Size | 1345 |
Cytogenetics | 13 B1 |
Refseq ORF | 942 |
Synonyms | C77140; W91705 |
Summary | Catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA (By similarity). Also has itaconyl-CoA hydratase activity by converting itaconyl-CoA into citramalyl-CoA in the C5-dicarboxylate catabolism pathway (By similarity). The C5-dicarboxylate catabolism pathway is required to detoxify itaconate, a vitamin B12-poisoning metabolite (By similarity). Has very low enoyl-CoA hydratase activity (PubMed:10072761). Was originally identified as RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs (PubMed:10072761).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |