B3galt5 (NM_033149) Mouse Recombinant Protein

CAT#: TP504357

Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 (B3galt5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rat Monoclonal SSEA-3 Antibody (MC-631)
    • 100 ul

CNY 5,381.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204357 protein sequence
Red=Cloning site Green=Tags(s)

MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQIPDIDCKQKPPFLVLLVTSSHKQLAA
RMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWV
YHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPP
FCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIV
ACHFMKPQDLLTYWQALENSKEQDCPAV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_149161
Locus ID 93961
UniProt ID Q9JI67
Refseq Size 4914
Cytogenetics 16 C4
Refseq ORF 927
Synonyms 1190002B21Rik; AU045265; b3Galt-V
Summary Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor. Also catalyzes the transfer of Gal to the terminal GalNAc unit of the globoside GB4, thereby synthesizing the glycolipid GB5, also known as the stage-specific embryonic antigen-3 (SSEA-3).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...