Pex19 (NM_023041) Mouse Recombinant Protein

CAT#: TP504168

Purified recombinant protein of Mouse peroxisomal biogenesis factor 19 (Pex19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204168 protein sequence
Red=Cloning site Green=Tags(s)

MAAAEEGCGVGVEDDRELEELLESALDDFDKAKPSPEHAPTISAPDASGPQKRAPGDTAKDALFASQEKF
FQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLSGLAKNA
TELQNSGMSEEELMKAMEGLGMDEGDGEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDST
PPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDL
DALNLSGPPGANGEQCLIM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075528
Locus ID 19298
UniProt ID Q8VCI5
Refseq Size 3131
Cytogenetics 1 79.54 cM
Refseq ORF 900
Synonyms Pxf
Summary Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...