Ubxn1 (NM_146093) Mouse Recombinant Protein
CAT#: TP504123
Purified recombinant protein of Mouse UBX domain protein 1 (Ubxn1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204123 representing NM_146093
Red=Cloning site Green=Tags(s) MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLSHVLGREPTPSEQV GPEGSGSAAGESRPILTEEERQEQTKRMLELVAQKQREREEREEREALEREKQRRRQGQELSVARQKLQE DEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSRSSPPATDPGPVPSSPSQEPPTKRE YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEEPGQDQDPVQLLSGFPRRAFSEADMERPLQE LGLVPSAVLIVAKKCPS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 34 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_666205 |
Locus ID | 225896 |
UniProt ID | Q922Y1 |
Refseq Size | 1048 |
Cytogenetics | 19 A |
Refseq ORF | 891 |
Synonyms | 2B28; 4930455J02Rik; D19Ertd721e; T25529 |
Summary | Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In turn, interferes with MAVS oligomerization, and disrupts the MAVS/TRAF3/TRAF6 signalosome. This function probably serves as a brake to prevent excessive RLR signaling. Interferes with the TNFalpha-triggered NF-kappa-B pathway by interacting with cellular inhibitors of apoptosis proteins (cIAPs) and thereby inhibiting their recruitment to TNFR1. Prevents also the activation of NF-kappa-B by associating with CUL1 and thus inhibiting NF-kappa-B inhibitor alpha/NFKBIA degradation that remains bound to NF-kappa-B. Interacts with the BRCA1-BARD1 heterodimer and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1 leads to the inhibition of the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer. Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |