Nhej1 (NM_029342) Mouse Recombinant Protein

CAT#: TP504061

Purified recombinant protein of Mouse non-homologous end joining factor 1 (Nhej1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204061 protein sequence
Red=Cloning site Green=Tags(s)

MEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA
ALLCHLDEALRPLFKDSAHPSKATFSCDRGEEGLILRVQSELSGLPFSWHFHCIPASSSLVSQHLIHPLM
GVSLALQSHVRELAALLRMKDLEIQAYQESGAVLSRSRLKTEPFEENSFLEQFMAEKLPEACAVGDGKPF
AMSLQSLYVAVTKQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPVAASGPMHRA
QLVKSKRKKPRGLFS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083618
Locus ID 75570
UniProt ID Q3KNJ2
Refseq Size 1415
Cytogenetics 1 C4
Refseq ORF 888
Synonyms 1700029B21Rik; cernunnos; XLF
Summary DNA repair protein involved in DNA nonhomologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. May serve as a bridge between XRCC4 and the other NHEJ factors located at DNA ends, or may participate in reconfiguration of the end bound NHEJ factors to allow XRCC4 access to the DNA termini. It may act in concert with XRCC6/XRCC5 (Ku) to stimulate XRCC4-mediated joining of blunt ends and several types of mismatched ends that are noncomplementary or partially complementary (PubMed:17360556). Binds DNA in a length-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...