Aktip (NM_010241) Mouse Recombinant Protein

CAT#: TP504014

Purified recombinant protein of Mouse thymoma viral proto-oncogene 1 interacting protein (Aktip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204014 protein sequence
Red=Cloning site Green=Tags(s)

MNPLWSMSAGSVRKRAEGEEKTLAGDVKTSPPRSAPKKQLPSIPKNALPIAKPTSPAPAAQSTNGTHASY
GPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALVWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRL
LFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTTSPLNPEAAVLYEKDIQLFK
SKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPDEQHNKSVHVAGLSWVKPGSV
QPFSKEEKTVAT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034371
Locus ID 14339
UniProt ID Q64362
Refseq Size 2173
Cytogenetics 8 44.25 cM
Refseq ORF 879
Synonyms AL023020; Fif; Ft; Ft1; Fts
Summary Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). Regulates apoptosis by enhancing phosphorylation and activation of AKT1. Increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...