Snrpa (NM_015782) Mouse Recombinant Protein
CAT#: TP503911
Purified recombinant protein of Mouse small nuclear ribonucleoprotein polypeptide A (Snrpa), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203911 protein sequence
Red=Cloning site Green=Tags(s) MATIATMPVPETRANHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRIMKMRGQAFVIFKEVTS ATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTYVERDRKREKRKPKSQETPAAKKAVQGGAAAPVV GAVQPVPGMPPMPQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENP PNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAM KISFAKK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056597 |
Locus ID | 53607 |
UniProt ID | Q62189 |
Refseq Size | 1382 |
Cytogenetics | 7 A3 |
Refseq ORF | 864 |
Synonyms | C430021M15Rik; Rnu1a-1; Rnu1a1; U1-A; U1A |
Summary | Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1 snRNP is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. May bind preferentially to the 5'-UGCAC-3' motif on RNAs (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |