Plekhf1 (NM_024413) Mouse Recombinant Protein
CAT#: TP503775
Purified recombinant protein of Mouse pleckstrin homology domain containing, family F (with FYVE domain) member 1 (Plekhf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203775 protein sequence
Red=Cloning site Green=Tags(s) MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFNDILVYGSIVLS KRKYRSQHIIPLEEVTLEPLPETLQAKNRWMIKTAKKSFVVSAASTTERQEWISHIEECVRRQLLATGRQ PTTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGFVVCAECSRERFLLPRLSPKPLRVCSLCYRE LAAQKRREEAREGIGGSPPQLSHLGGTVCGASSGDDDDSDEDREGNGDGDWPTQVEFYASGVSWSAFHS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 31.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077724 |
Locus ID | 72287 |
UniProt ID | Q3TB82 |
Refseq Size | 1559 |
Cytogenetics | 7 B3 |
Refseq ORF | 840 |
Synonyms | 1810013P09Rik; APPD; LAPF; PHAFIN1; ZFYVE15 |
Summary | May induce apoptosis through the lysosomal-mitochondrial pathway. Translocates to the lysosome initiating the permeabilization of lysosomal membrane (LMP) and resulting in the release of CTSD and CTSL to the cytoplasm. Triggers the caspase-independent apoptosis by altering mitochondrial membrane permeabilization (MMP) resulting in the release of PDCD8 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Plekhf1产品