Cbr1 (NM_007620) Mouse Recombinant Protein
CAT#: TP503724
Purified recombinant protein of Mouse carbonyl reductase 1 (Cbr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203724 protein sequence
Red=Cloning site Green=Tags(s) MSSSRPVALVTGANKGIGFAITRDLCRKFSGDVVLAARDEERGQTAVQKLQAEGLSPRFHQLDIDNPQSI RALRDFLLKEYGGLDVLVNNAGIAFKVNDDTPFHIQAEVTMKTNFFGTRDVCKELLPLIKPQGRVVNVSS MVSLRALKNCRLELQQKFRSETITEEELVGLMNKFVEDTKKGVHAEEGWPNSAYGVTKIGVTVLSRILAR KLNEQRRGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVQDKKVEPW myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031646 |
Locus ID | 12408 |
UniProt ID | P48758 |
Refseq Size | 1081 |
Cytogenetics | 16 54.53 cM |
Refseq ORF | 834 |
Synonyms | AW261796; Cbr; CR |
Summary | NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |