Inmt (NM_009349) Mouse Recombinant Protein
CAT#: TP503504
Purified recombinant protein of Mouse indolethylamine N-methyltransferase (Inmt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203504 protein sequence
Red=Cloning site Green=Tags(s) MEGKVYIGGEDYEKEFTPKDYLTTYYSFHSGPVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIY QLLSACEVFREIIVTDYTPQNLQELQKWLKKEPGAYDWSSIVQHACELEGDRSRWQEKEAKLRRTVTRVL RCDVTKTPPLGSAQVPLADCVLTFLAMECACPDIDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPK KFSGVYLEKEVVEKAIQDAGCQVLKCNCVSLSYSEAYCSHDGLCFVVARKGPSA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 29.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033375 |
Locus ID | 21743 |
UniProt ID | P40936 |
Refseq Size | 1023 |
Cytogenetics | 6 B3 |
Refseq ORF | 795 |
Synonyms | Temt |
Summary | Catalyzes the N-methylation of tryptamine and structurally related compounds (By similarity). Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |