Mrrf (NM_026422) Mouse Recombinant Protein

CAT#: TP503450

Purified recombinant protein of Mouse mitochondrial ribosome recycling factor (Mrrf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203450 protein sequence
Red=Cloning site Green=Tags(s)

MASGIRCFRLLHPAFRSYHAALTRPVSEVSMKTVSGRQHGHRQYSAYPAVPVRHFATKKAKAKGKGQPQA
RVTVNRALVEDIISLEEVDEDMKSVVEALKDNFNKTLNIRTAPGSLDHITVVTADGKVALNQIGQISMKS
PQVILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPKVTREHREMLVKLAKQNTNKAKENLRK
VRTNAMNKLKKSKDKTSEDTIRLIEKQISQMADDTVAELDQHLAAKTKELLG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080698
Locus ID 67871
UniProt ID Q9D6S7
Refseq Size 2251
Cytogenetics 2 B
Refseq ORF 789
Synonyms 2400002D02Rik; MRFF; MTRRF; RRF
Summary Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...