Dhrs11 (NM_177564) Mouse Recombinant Protein

CAT#: TP503373

Purified recombinant protein of Mouse dehydrogenase/reductase (SDR family) member 11 (Dhrs11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203373 protein sequence
Red=Cloning site Green=Tags(s)

MTRAGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD
LSNEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN
IDDGHIININSMCGHRVPPQSVIHFYSATKYAVTALTEGLRQELLEAQTHIRATCISPGLVETQFAFKLH
DKDPGEAAATYEHIKCLRPEDVAEAVIYVLSTPPHVQVGDIQMRPTEQVT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_808232
Locus ID 192970
UniProt ID Q3U0B3
Refseq Size 1421
Cytogenetics 11 C
Refseq ORF 783
Synonyms MGC18716
Summary Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta-hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...