Rfxank (NM_001025589) Mouse Recombinant Protein
CAT#: TP503366
Purified recombinant protein of Mouse regulatory factor X-associated ankyrin-containing protein (Rfxank), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203366 protein sequence
Red=Cloning site Green=Tags(s) MEPTQVAENLVPNQQPPVPDLEDPEDTRDESPENSDTVVLSLFPCTPDAVNPEADASASSLQGSFLKHST TLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKDHLRKGNNLINKPDERGFTPLIWASAFGEIETVR FLLDWGADPHILAKERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLA RGADLTTEADSGYTPMDLAVALGYRKVQQVMESHILRLFQSTLGPVDPE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001020760 |
Locus ID | 19727 |
UniProt ID | Q9Z205, Q543F0 |
Refseq Size | 3652 |
Cytogenetics | 8 B3.3 |
Refseq ORF | 780 |
Synonyms | Tvl1 |
Summary | Activates transcription from class II MHC promoters. Activation requires the activity of the MHC class II transactivator/CIITA. May regulate other genes in the cell. RFX binds the X1 box of MHC-II promoters (By similarity). May also potentiate the activation of RAF1 (PubMed:10329666).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |