Emc10 (NM_197991) Mouse Recombinant Protein

CAT#: TP503345

Purified recombinant protein of Mouse ER membrane protein complex subunit 10 (Emc10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203345 protein sequence
Red=Cloning site Green=Tags(s)

MVAAGAGVTRLLVLLLMVAAAPSRARGSGCRVGASARGTGADGREAEGCGTVALLLEHSFELGDGANFQK
RGSLLWNQQDGTLSATQRQLSEEERGRLRDVAAVNGLYRVRVPRRPGTLDGSEAGGHVSSFVPACSLVES
HLSDQLTLHVDVAGNVVGLSVVVYPGGCRGSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIERLEMEQA
QKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDAGGQGGGGGGGSSR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_932108
Locus ID 69683
UniProt ID Q3TAS6, A0A0X1KG67
Refseq Size 1855
Cytogenetics 7 B3
Refseq ORF 777
Synonyms 2310044H10Rik; 5430410O10Rik; Inm02; Mirta22
Summary Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...