Fam192a (NM_028221) Mouse Recombinant Protein
CAT#: TP503248
Purified recombinant protein of Mouse family with sequence similarity 192, member A (Fam192a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203248 protein sequence
Red=Cloning site Green=Tags(s) MDGEDDSNLVIKKRFVSEAELDERRKRRQEEWEKVRKPEDPKECPEEAYDPRSLYERLQEQKDRKQQEYE EQFKFKNMVRGLDEDETNFLDEVSRQQDLIEKQRREEELEELKEYRSNLNKVGISAENKEVEKKLAVKPI ETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPDPDDKAQEAPSCMSLGSSSLSGPPSIHCPSAAVCIG ILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082497 |
Locus ID | 102122 |
UniProt ID | Q91WE2 |
Refseq Size | 1812 |
Cytogenetics | 8 C5 |
Refseq ORF | 765 |
Synonyms | 1700001O11Rik; 2310065K24Rik; AI596259; Nip30 |
Summary | Promotes the association of the proteasome activator complex subunit PSME3 with the 20S proteasome and regulates its activity. Inhibits PSME3-mediated degradation of some proteasome substrates, probably by affecting their diffusion rate into the catalytic chamber of the proteasome. Also inhibits the interaction of PSME3 with COIL, inhibits accumulation of PSME3 in Cajal bodies and positively regulates the number of Cajal bodies in the nucleus.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Fam192a产品