Meox1 (NM_010791) Mouse Recombinant Protein

CAT#: TP503243

Purified recombinant protein of Mouse mesenchyme homeobox 1 (Meox1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203243 protein sequence
Red=Cloning site Green=Tags(s)

MDPVANSCVRNPQPPAPVWGCLRNPHSEDSSASGLSHYPPTPFSFHQKSDFPATAAYPDFSASCLAATPH
SLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTAGLGEDCMVLGTIAN
ETEKKSSRRKKERSDNQENGGGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLS
ERQVKVWFQNRRMKWKRVKGGQPVSPQEQDREDGDSAASPSSE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034921
Locus ID 17285
UniProt ID P32442
Refseq Size 2235
Cytogenetics 11 65.48 cM
Refseq ORF 762
Synonyms AI385561; D330041M02Rik; Mox-1; Mox1
Summary Mesodermal transcription factor that plays a key role in somitogenesis and is specifically required for sclerotome development. Required for maintenance of the sclerotome polarity and formation of the cranio-cervical joints (PubMed:19520072). Binds specifically to the promoter of target genes and regulates their expression. Activates expression of NKX3-2 in the sclerotome (PubMed:15024065). Activates expression of CDKN1A and CDKN2A in endothelial cells, acting as a regulator of vascular cell proliferation. While it activates CDKN1A in a DNA-dependent manner, it activates CDKN2A in a DNA-independent manner (PubMed:22206000). Required for hematopoietic stem cell (HSCs) induction via its role in somitogenesis: specification of HSCs occurs via the deployment of a specific endothelial precursor population, which arises within a sub-compartment of the somite named endotome (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...