Gtf2f2 (NM_026816) Mouse Recombinant Protein
CAT#: TP503175
Purified recombinant protein of Mouse general transcription factor IIF, polypeptide 2 (Gtf2f2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203175 protein sequence
Red=Cloning site Green=Tags(s) MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKNQGRTEVSFTLNEDLANIHDIGG KPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMKLKRLQIEESSKPVR LSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPV GYLKEILKEIGIQNVKGIHKNTWELKPEYRHYQTEEKSD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081092 |
Locus ID | 68705 |
UniProt ID | Q8R0A0 |
Refseq Size | 1467 |
Cytogenetics | 14 D3 |
Refseq ORF | 750 |
Synonyms | 1110031C13Rik; AI326315 |
Summary | TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |