Psme1 (NM_011189) Mouse Recombinant Protein
CAT#: TP503169
Purified recombinant protein of Mouse proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) (Psme1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203169 protein sequence
Red=Cloning site Green=Tags(s) MATLRVHPEAQAKVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVK EKEKEERKKQQEKEEKEEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPEIKDVTEQLNLVTTWLQLQIP RIEDGNNFGVAVQEKVFELMTNLHTKLEGFHTQISKYFSERGDAVAKAAKQPHVGDYRQLVHELDEAEYQ EIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035319 |
Locus ID | 19186 |
UniProt ID | P97371, Q5HZK3 |
Refseq Size | 977 |
Cytogenetics | 14 28.19 cM |
Refseq ORF | 750 |
Synonyms | AW413925; PA28a |
Summary | Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |