Bdh2 (NM_027208) Mouse Recombinant Protein

CAT#: TP503075

Purified recombinant protein of Mouse 3-hydroxybutyrate dehydrogenase, type 2 (Bdh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203075 protein sequence
Red=Cloning site Green=Tags(s)

MGRLDGKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKLQELESYRGIQTRVLDVTKKRQIDQFAS
EIERIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKMLAQKSGNIINMSSVASSIKG
VENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARDNPKEALKTFLNRQKTGR
FASAEEVALLCVYLASDESAYVTGNPVIIDGGWSL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081484
Locus ID 69772
UniProt ID Q8JZV9
Refseq Size 1099
Cytogenetics 3 G3
Refseq ORF 738
Synonyms 1810026B04Rik; Dhrs6
Summary Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron assimilation and homeostasis (PubMed:20550936, PubMed:24863067). Plays a role in susceptibility to bacterial infection by providing an assimilable source of iron that is exploited by pathogenic bacteria (PubMed:24863067). Also acts as a 3-hydroxybutyrate dehydrogenase (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...