Apip (NM_019735) Mouse Recombinant Protein
CAT#: TP502974
Purified recombinant protein of Mouse APAF1 interacting protein (Apip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202974 protein sequence
Red=Cloning site Green=Tags(s) MSGCQAQGDCCSRPCGAQDKEHPRFLIPELCKQFYHLGWVTGTGGGISLKHGNEIYIAPSGVQKERIQPE DMFVCDINEQDISGPPASKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGQEFKITHQEMI KGIRKCTSGGYYRYDDMLVVPIIENTPEEKDLKERMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMC ECYDYLFDIAVSMKKMGLDPTQLPVGENGIV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062709 |
Locus ID | 56369 |
UniProt ID | Q9WVQ5 |
Refseq Size | 924 |
Cytogenetics | 2 E2 |
Refseq ORF | 726 |
Synonyms | APIP2; CGI-29; Mmrp19 |
Summary | Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Functions in the methionine salvage pathway, which plays a key role in cancer, apoptosis, microbial proliferation and inflammation. May inhibit the CASP1-related inflammatory response (pyroptosis), the CASP9-dependent apoptotic pathway and the cytochrome c-dependent and APAF1-mediated cell death.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |