Laptm4b (NM_033521) Mouse Recombinant Protein

CAT#: TP502675

Purified recombinant protein of Mouse lysosomal-associated protein transmembrane 4B (Laptm4b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202675 protein sequence
Red=Cloning site Green=Tags(s)

MKMVAPWTRFYSHSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPNQYHFSGSELGGEFEFMDDA
NMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAITVLVYPNSIQEYIRQLPPSF
PYRDDIMSVNPTCLVLIILLFIGILLTLKGYLISCVWSCYRYINGRNSSDVLVYVTSNDTTVLLPPYDDA
TAVPSTAKEPPPPYVSA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_277056
Locus ID 114128
UniProt ID Q91XQ6
Refseq Size 1897
Cytogenetics 15 B3.1
Refseq ORF 684
Synonyms C330023P13Rik; LAPTM4beta
Summary Required for optimal lysosomal function. Blocks EGF-stimulated EGFR intraluminal sorting and degradation. Conversely by binding with the phosphatidylinositol 4,5-bisphosphate, regulates its PIP5K1C interaction, inhibits HGS ubiquitination and relieves LAPTM4B inhibition of EGFR degradation. Recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, promoting entry of leucine and other essential amino acid (EAA) into the lysosome, stimulating activation of proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and hence mTORC1 activation. Plays a role as negative regulator of TGFB1 production in regulatory T cells. Binds ceramide and facilitates its exit from late endosome in order to control cell death pathways.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...