Commd5 (NM_025536) Mouse Recombinant Protein
CAT#: TP502621
Purified recombinant protein of Mouse COMM domain containing 5 (Commd5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202621 protein sequence
Red=Cloning site Green=Tags(s) MSALGAPAPYLHHPTDSHSGRVSFLGSQPSAEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVQH LGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQDELQELGIPQDMIGDLASLAFGSQRPLLDS VAQQQGSSLPRVSNFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKE MAELERKCERKLQD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 24.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079812 |
Locus ID | 66398 |
UniProt ID | Q8R395 |
Refseq Size | 998 |
Cytogenetics | 15 36.28 cM |
Refseq ORF | 675 |
Synonyms | 2310065H03Rik; AI854466; D15Ertd81e; Hcarg |
Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. Negatively regulates cell proliferation. Negatively regulates cell cycle G2/M phase transition probably by transactivating p21/CDKN1A through the p53/TP53-independent signaling pathway. Involved in kidney proximal tubule morphogenesis. Down-regulates activation of NF-kappa-B.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |