Polr3gl (NM_027241) Mouse Recombinant Protein

CAT#: TP502455

Purified recombinant protein of Mouse polymerase (RNA) III (DNA directed) polypeptide G like (Polr3gl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202455 protein sequence
Red=Cloning site Green=Tags(s)

MASRGGGRGRGRGQLTFNMEAVGIGKGDALPPPTLQPSPLFPPLEFHPVPLPAGEEGEYVLALKQELRGA
MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPSELKIRVRKVQKERTTIILPKRPPKS
TDDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEGEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD
DNMDEAHILKNLGID

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081517
Locus ID 69870
UniProt ID Q8R0C0
Refseq Size 1427
Cytogenetics 3 F2.1
Refseq ORF 678
Synonyms 2010003I19Rik
Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...