Rab39 (NM_175562) Mouse Recombinant Protein
CAT#: TP502421
Purified recombinant protein of Mouse RAB39, member RAS oncogene family (Rab39), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202421 representing NM_175562
Red=Cloning site Green=Tags(s) METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTA GQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSRE EAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVK PRKECFC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_780771 |
Locus ID | 270160 |
UniProt ID | Q8BHD0, Q0PD15 |
Refseq Size | 2971 |
Cytogenetics | 9 A5.3 |
Refseq ORF | 651 |
Synonyms | C230094F14Rik; Rab39a |
Summary | Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K (By similarity). May be involved in multiple neurite formation (PubMed:23624502).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |