Gltp (NM_019821) Mouse Recombinant Protein

CAT#: TP502228

Purified recombinant protein of Mouse glycolipid transfer protein (Gltp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202228 protein sequence
Red=Cloning site Green=Tags(s)

MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTL
QNILEVEKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYH
GWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062795
Locus ID 56356
UniProt ID Q9JL62
Refseq Size 1622
Cytogenetics 5 F
Refseq ORF 630
Synonyms 1110001F24Rik; C76925; C77564
Summary Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...