Mad2l1 (NM_019499) Mouse Recombinant Protein
CAT#: TP502160
Purified recombinant protein of Mouse MAD2 mitotic arrest deficient-like 1 (Mad2l1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202160 representing NM_019499
Red=Cloning site Green=Tags(s) MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPELIKYLNNVVE QLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKSQKAIQDEIRSVIRQITATVT FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEEVRLRSFTTTIHKVNSMVAYKTPVND myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 24 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062372 |
Locus ID | 56150 |
UniProt ID | Q9Z1B5 |
Refseq Size | 1725 |
Cytogenetics | 6 30.56 cM |
Refseq ORF | 615 |
Synonyms | AA673185; MAD2 |
Summary | Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |