Drap1 (NM_024176) Mouse Recombinant Protein
CAT#: TP502156
Purified recombinant protein of Mouse Dr1 associated protein 1 (negative cofactor 2 alpha) (Drap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202156 representing NM_024176
Red=Cloning site Green=Tags(s) MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHL KQCIELEQQFDFLKDLVASVPDMQGDGEDNHVDGDKGPRRGRKPGSSGRKNGGTGSKGKDKKLSGTDSEQ EDESEDTDTDGEEETPQLPPQASHPPAHFQSPPTPFIPFTSPLPLPPAPPGPSAADAEDEEDYDS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077138 |
Locus ID | 66556 |
UniProt ID | Q9D6N5 |
Refseq Size | 999 |
Cytogenetics | 19 A |
Refseq ORF | 615 |
Synonyms | 2310074H19Rik; NC2-alpha |
Summary | The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |