Bcl7b (NM_009745) Mouse Recombinant Protein
CAT#: TP502084
Purified recombinant protein of Mouse B cell CLL/lymphoma 7B (Bcl7b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202084 representing NM_009745
Red=Cloning site Green=Tags(s) MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNNTAAREP NGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLG QEILEEPSLPASEVADEPPTLTKEEPVPVETQTTEEEEDSGAPPLKRFCVDQPVVPQTTSES myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033875 |
Locus ID | 12054 |
UniProt ID | Q921K9 |
Refseq Size | 1678 |
Cytogenetics | 5 G2 |
Refseq ORF | 606 |
Summary | Positive regulator of apoptosis. Plays a role in the Wnt signaling pathway, negatively regulating the expression of Wnt signaling components CTNNB1 and HMGA1 (By similarity). Involved in cell cycle progression, maintenance of the nuclear structure and stem cell differentiation (By similarity). May play a role in lung tumor development or progression.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |