Itpa (NM_025922) Mouse Recombinant Protein
CAT#: TP501990
Purified recombinant protein of Mouse inosine triphosphatase (nucleoside triphosphate pyrophosphatase) (Itpa), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201990 protein sequence
Red=Cloning site Green=Tags(s) MAASLVGKKIVFVTGNAKKLEEVIQILGDNFPCTLEAQKIDLPEYQGEPDEISIQKCREAARQVQGPVLV EDTCLCFNALGGLPGPYIKWFLQKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVLLFRGQTSGQI VMPRGSRDFGWDPCFQPDGYEQTYAEMPKSEKNTISHRFRALHKLQEYFSVAAGAGDH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080198 |
Locus ID | 16434 |
UniProt ID | Q9D892 |
Refseq Size | 1264 |
Cytogenetics | 2 63.24 cM |
Refseq ORF | 597 |
Synonyms | 2010016I08Rik; AU020102; Itp |
Summary | Pyrophosphatase that hydrolyzes the non-canonical purine nucleotides inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) as well as 2'-deoxy-N-6-hydroxylaminopurine triposphate (dHAPTP) and xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |