Tnfaip8 (NM_134131) Mouse Recombinant Protein

CAT#: TP501983

Purified recombinant protein of Mouse tumor necrosis factor, alpha-induced protein 8 (Tnfaip8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201983 protein sequence
Red=Cloning site Green=Tags(s)

MLSEAEEPREVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAER
VIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLH
EIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLDEENI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 23 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598892
Locus ID 106869
UniProt ID Q921Z5, D3Z325
Refseq Size 3368
Cytogenetics 18 D1
Refseq ORF 597
Synonyms AA987150; E130304C20Rik; ENSMUSG00000073567; Gg2-1; Gm10539; Nded; Ssc-2; Tipe
Summary Acts as a negative mediator of apoptosis. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...