Nkiras1 (NM_023526) Mouse Recombinant Protein
CAT#: TP501849
Purified recombinant protein of Mouse NFKB inhibitor interacting Ras-like protein 1 (Nkiras1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201849 protein sequence
Red=Cloning site Green=Tags(s) MGKGCKVVICGLLSVGKTAILEQLLYGNHTIGMEDCETLEDVYMASVETDRGVKEQLHLYDTRGLQKGVE LPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKLDLSEQRQVDADVAQQWAR SEKVKLWEVTVTDRRTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNPEN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076015 |
Locus ID | 69721 |
UniProt ID | Q8CEC5 |
Refseq Size | 4592 |
Cytogenetics | 14 A1 |
Refseq ORF | 579 |
Synonyms | 2400004O09Rik; kappaB-Ras1; KBRAS1 |
Summary | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Nkiras1产品