Ociad1 (NM_001159888) Mouse Recombinant Protein
CAT#: TP501797
Purified recombinant protein of Mouse OCIA domain containing 1 (Ociad1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201797 protein sequence
Red=Cloning site Green=Tags(s) MNGRADFREPNAQVSRPIPDIGGGYIPTEEEWRLFAECHEECFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLLFACIVGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGELRRSSPPGHYTQKPKFDSNVSG QSSFGTSPAADNIEKEALPRYEPIPFSASMNESTPTGITDHIAQGRNFS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001153360 |
Locus ID | 68095 |
UniProt ID | Q9CRD0 |
Refseq Size | 1421 |
Cytogenetics | 5 C3.2 |
Refseq ORF | 570 |
Synonyms | 6030432N09Rik; AI481327; Asrij; AW557942; B230209J16Rik; BB021357; Emi2; Imi2; OCIA; TPA018 |
Summary | Maintains stem cell potency (PubMed:23972987). Increases STAT3 phosphorylation and controls ERK phosphorylation (PubMed:23972987). May act as a scaffold, increasing STAT3 recruitment onto endosomes (PubMed:23972987).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |