Dusp18 (NM_173745) Mouse Recombinant Protein
CAT#: TP501769
Purified recombinant protein of Mouse dual specificity phosphatase 18 (Dusp18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201769 protein sequence
Red=Cloning site Green=Tags(s) MTSPWSAFPVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTFYEDIQYVQVP VVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPI IRPNSGFWEQLIHYELQLFGKNTMQMMDSPMGRIPDIYEKETRLMIPL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 21.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_776106 |
Locus ID | 75219 |
UniProt ID | Q8VE01, Q8BWD7 |
Refseq Size | 4632 |
Cytogenetics | 11 A1 |
Refseq ORF | 567 |
Synonyms | 4930527G07Rik; AI430870; BB028064; DSP18; DUSP20; LMWDSP20 |
Summary | Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. In vitro, dephosphorylates p-nitrophenyl phosphate (pNPP).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |