Dhps (BC039963) Mouse Recombinant Protein
CAT#: TP501742
Purified recombinant protein of Mouse deoxyhypusine synthase (cDNA clone MGC:49129 IMAGE:4240646), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201742 protein sequence
Red=Cloning site Green=Tags(s) MPILDQMVLEQNTEGVKWTPSKMISRLGKEINNPDSVYYWAHKNHIPVLSPALTDGSLGDMIFFHSYKNP GLVLDIVEDLRLINTQAIFAKRSGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDE AVSWGKIRMDAQPVKVYADASLVFPLLVAETFAQKADAFRAEKNED myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 330817 |
UniProt ID | Q3TXU5 |
Refseq Size | 1149 |
Cytogenetics | 8 C3 |
Refseq ORF | 558 |
Synonyms | Dhs, MGC49129, MGC74384 |
Summary | Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a critical lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue. This is the first step of the post-translational modification of that lysine into an unusual amino acid residue named hypusine. Hypusination is unique to mature eIF-5A factor and is essential for its function.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |