Cenpm (NM_001080158) Mouse Recombinant Protein

CAT#: TP501638

Purified recombinant protein of Mouse centromere protein M (Cenpm), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201638 protein sequence
Red=Cloning site Green=Tags(s)

MSVLRSMDKLPDLNRATVLLVSTEDALLQQLAESMLKDDCASELRVHLANSLPLPSNVNRPRIDLIVFVI
NLHSKYSLQKVEEFLQHVDSSFFLGKVCFLVTGAGQESHCSVHQNTVIKLAHTYRSPLFLCDLQKVESFR
AAMARRLVRILQICAGHVPGVSALNLMSLLRSPENPPSKEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 20.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001073627
Locus ID 66570
UniProt ID Q9CQA0
Refseq Size 1217
Cytogenetics 15 E1
Refseq ORF 546
Synonyms 2610019I03Rik; AI853711; Pane1
Summary This gene encodes a protein that is present in the nucleus of actively growing cells but is excluded from the nucleus during cell division or during growth arrest as a result of contact inhibition. In human, this protein is a component of the CENP-A nucleosome-associated complex that regulates kinetochore protein assembly, mitotic cell-cycle progression, and chromosome segregation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...