Spcs3 (NM_029701) Mouse Recombinant Protein
CAT#: TP501602
Purified recombinant protein of Mouse signal peptidase complex subunit 3 homolog (S. cerevisiae) (Spcs3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201602 protein sequence
Red=Cloning site Green=Tags(s) MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDI TADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNR NVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 20.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083977 |
Locus ID | 76687 |
UniProt ID | Q6ZWQ7 |
Refseq Size | 3482 |
Cytogenetics | 8 B1.3 |
Refseq ORF | 543 |
Synonyms | 1810011E08Rik; SPC22/23 |
Summary | Component of the microsomal signal peptidase complex which removes signal peptides and other N-terminal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |