Ppih (NM_028677) Mouse Recombinant Protein
CAT#: TP501558
Purified recombinant protein of Mouse peptidyl prolyl isomerase H (Ppih), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201558 protein sequence
Red=Cloning site Green=Tags(s) MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082953 |
Locus ID | 66101 |
UniProt ID | Q9D868 |
Refseq Size | 795 |
Cytogenetics | 4 55.34 cM |
Refseq ORF | 534 |
Synonyms | 1100001J08Rik; 2010111B15Rik; 4833408F11Rik; AI464484; CYP-20; CYPH; D4Wsu43e |
Summary | PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex, one of the building blocks of the spliceosome. May act as a chaperone.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |