Map2k3 (BC007467) Mouse Recombinant Protein
CAT#: TP501496
Purified recombinant protein of Mouse mitogen activated protein kinase kinase 3 (cDNA clone MGC:5915 IMAGE:3497714), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201496 protein sequence
Red=Cloning site Green=Tags(s) MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL GRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICM ELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSM myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 26397 |
UniProt ID | O09110 |
Refseq Size | 2096 |
Cytogenetics | 11 B2 |
Refseq ORF | 519 |
Synonyms | MEK3, MKK3, mMKK3b |
Summary | Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |