C530044N13Rik (BC034347) Mouse Recombinant Protein

CAT#: TP501448

Purified recombinant protein of Mouse RIKEN cDNA C530044N13 gene (cDNA clone MGC:27760 IMAGE:2654874), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR201448 protein sequence
Red=Cloning site Green=Tags(s)

MERSILLRPRRRHSVWTDEGLVLNSQFLYDASRCPALKQAQDHWLDQQLNIAEQKQCQHAIVFQHIPLFL
QSIDEDDDYFNLTKTVRKELAEKLTRAGIRAVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGKDTHGLRVV
AITAEKIVHRYYSLDELSQGGVEEDLKELLKE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 19.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 223978
UniProt ID Q8BFS6
Refseq Size 2343
Cytogenetics 16 A1
Refseq ORF 516
Synonyms MGC27760
Summary Protein phosphatase that dephosphorylates AKT family kinase specifically at 'Ser-473', blocking cell cycle progression and promoting cell apoptosis. May play an inhibitory role in glucose uptake by adipocytes (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...