Lmo4 (NM_010723) Mouse Recombinant Protein
CAT#: TP501329
Purified recombinant protein of Mouse LIM domain only 4 (Lmo4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Cited in 1 publication. |
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201329 protein sequence
Red=Cloning site Green=Tags(s) MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD RPTALINGHLNSLQSNPLLPDQKVC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 18 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034853 |
Locus ID | 16911 |
UniProt ID | P61969, Q542S1 |
Refseq Size | 1704 |
Cytogenetics | 3 68.61 cM |
Refseq ORF | 498 |
Synonyms | A730077C12Rik; Crp3; Etohi4 |
Summary | Probable transcriptional factor.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Cisplatin-induced Ototoxicity Is Mediated by Nitroxidative Modification of Cochlear Proteins Characterized by Nitration of Lmo4 *
,null,
The Journal of Biological Chemistry
,PubMed ID 22493493
[Lmo4]
|
Documents
FAQs |
SDS |