Pigx (NM_024464) Mouse Recombinant Protein
CAT#: TP501059
Purified recombinant protein of Mouse phosphatidylinositol glycan anchor biosynthesis, class X (Pigx), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201059 protein sequence
Red=Cloning site Green=Tags(s) MLSESFNIEAPNYLSNESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLLMYCDQE FPILKCWAQSEVAAPCALKSEEICQWKSMQYKSILKNLTVQVPVGLTIHTSLVCSVTLLITILCSTLILL AVFKYGHFSL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_077784 |
Locus ID | 72084 |
UniProt ID | Q99LV7 |
Refseq Size | 1019 |
Cytogenetics | 16 B2 |
Refseq ORF | 453 |
Synonyms | 2010319C14Rik; PIG-X |
Summary | This gene encodes a type I transmembrane protein in the endoplasmic reticulum (ER). The protein is an essential component of glycosylphosphatidylinositol-mannosyltransferase I, which transfers the first of the four mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Studies in rat indicate that the protein is translated from a non-AUG translation initiation site. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |