Rnase4 (NM_201239) Mouse Recombinant Protein
CAT#: TP501018
Purified recombinant protein of Mouse ribonuclease, RNase A family 4 (Rnase4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201018 protein sequence
Red=Cloning site Green=Tags(s) MMDLQRTQSLLLLLVLTLLGLGLVQPSYGQDRMYQRFLRQHVDPQATGGNDNYCNVMMQRRKMTSVQCKR FNTFIHEDIWNIRGICSTTNILCKNGQMNCHEGVVKVTDCRETGNSKAPNCRYRARTSTRRVVIACEGDP EVPVHFDR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 17 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_957691 |
Locus ID | 58809 |
UniProt ID | Q8C7E4 |
Refseq Size | 1837 |
Cytogenetics | 14 C1 |
Refseq ORF | 447 |
Synonyms | C730049F20Rik; Rab1 |
Summary | This gene encodes a member of the pancreatic ribonuclease A superfamily. The encoded enzyme is sereted and has unique uridine specificity. This gene resides in a cluster of highly related genes. It shares dual promoters and 5' exons with the angiogenin, ribonuclease, RNase A family, 5 gene. Each gene splices to a unique downstream exon that contains its complete coding region. Two alternatively spliced variants, with different 5' exons but the same coding exon, have been identified. [provided by RefSeq, Jun 2009] |
Documents
FAQs |
SDS |