Brms1 (BC003485) Mouse Recombinant Protein

CAT#: TP500909

Purified recombinant protein of Mouse breast cancer metastasis-suppressor 1 (cDNA clone MGC:6927 IMAGE:2811430), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200909 protein sequence
Red=Cloning site Green=Tags(s)

MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEESSEMDDEDYERRRSECVSEMLDLEKQ
FSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQQSLKIRIQVAGIYKGFCLDVIRNKYECELQG
G

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 16.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 107392
UniProt ID Q99N20
Refseq Size 1212
Cytogenetics 19 A
Refseq ORF 423
Synonyms AV003220; AW554636
Summary Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controlled by NF-kappa-B. Promotes apoptosis in cells that have inadequate adherence to a substrate, a process called anoikis, and may thereby inhibit metastasis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...